English to Javanese Meaning of fish - iwak


Fish :
iwak

iwak

iwak, mbukak, nerbitaké, ndekek, nyebut, nyampekano informasi, jongkas, senapan

iwakfishediwakfishilyfishingamis
Facebook Twitter Linkedin Share More
Definitions of fish in English
Noun(1) any of various mostly cold-blooded aquatic vertebrates usually having scales and breathing through gills(2) the flesh of fish used as food(3) (astrology(4) the twelfth sign of the zodiac; the sun is in this sign from about February 19 to March 20
Verb(1) seek indirectly(2) catch or try to catch fish or shellfish
Examples of fish in English
(1) For a true taste of Croatian Adriatic cuisine seek out the tiny tavernas where you can eat superb local fish and sea food.(2) Some of this support surely comes from some of the same people who'd considered him something of a cold fish .(3) The diet advocates that concentrated carbohydrates like bread and concentrated protein foods like meat and fish should never be eaten at the same time.(4) She seems too sensitive to survive this earth and her cold fish of a husband, and indeed she doesn't.(5) Cindy began naming all the fish and those that were her favorites.(6) To prevent foodborne infection, your child also shouldn't eat raw fish , seafood, meat, or uncooked eggs.(7) Now, the final nail in the coffin, drastic cuts in the number of days our few remaining fishermen are allowed to fish our own waters.(8) If it was all the same guy I shall have to regard him as rather an odd fish .(9) Mack, for such a cold fish , is enthralling, partly because of the shimmer of uncertainty about what is true and what is not.(10) It is also important, for your purposes, whether she's a cold fish or just madder than hell at you.(11) they did fish the mountain streams when game grew scarce(12) smoked fish(13) a dinner of meat, dried fish, and bread(14) Sailors on board ships can then fish the swimmer out of the water.(15) George is now on a special dried food made of oily fish and tapioca, with occasional chicken or turkey as a treat.(16) This time he's playing a much more sympathetic character, but he's still a cold fish .
Related Phrases of fish
(1) fish and chips ::
iwak lan Kripik
(2) to fish ::
kanggo iwak
(3) tuna fish ::
iwak tuna
(4) fish tank ::
tank iwak
(5) a fish ::
iwak
(6) big fish ::
iwak gedhe
(7) grilled fish ::
iwak panggang
(8) fish oil ::
iwak lenga
(9) fish market ::
pasar iwak
(10) fried fish ::
iwak goreng
Synonyms
Verb
1. go fishing ::
mancing
2. search ::
search
3. try to get ::
nyoba kanggo njaluk
4. angle ::
amba
Different Forms
fish, fished, fishes, fishily, fishing, fishy
Word Example from TV Shows
but it's just cut up fish sticks
and a side of Uncle Ben's.

but it's just cut up FISH sticks and a side of Uncle Ben's.

The Big Bang Theory Season 5, Episode 6

Let the fish eat the scales off his eyes.

Let the FISH eat the scales off his eyes.

Game of Thrones Season 6, Episode 5

Like a fish, okay?
Like a drunk fish.

Like a FISH, okay? Like a drunk FISH.

Breaking Bad Season 2, Episode 10

Except, instead of pushing fish tacos
because they'll go bad...

Except, instead of pushing FISH tacos because they'll go bad...

The Big Bang Theory Season 8, Episode 1

A turkey stuffed with a brisket
stuffed with gefilte fish.

A turkey stuffed with a brisket stuffed with gefilte FISH.

The Big Bang Theory Season 3, Episode 4

English to Javanese Dictionary: fish

Meaning and definitions of fish, translation in Javanese language for fish with similar and opposite words. Also find spoken pronunciation of fish in Javanese and in English language.

Tags for the entry 'fish'

What fish means in Javanese, fish meaning in Javanese, fish definition, examples and pronunciation of fish in Javanese language.

Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History